Identificador persistente para citar o vincular este elemento:
http://hdl.handle.net/10553/121019
Campo DC | Valor | idioma |
---|---|---|
dc.contributor.author | Otazo-Perez, Andrea | en_US |
dc.contributor.author | Asensio-Calavia, Patricia | en_US |
dc.contributor.author | Gonzalez-Acosta, Sergio | en_US |
dc.contributor.author | Baca-Gonzalez, Victoria | en_US |
dc.contributor.author | López, Manuel R. | en_US |
dc.contributor.author | Morales De La Nuez, Antonio José | en_US |
dc.contributor.author | Pérez de la Lastra, José Manuel | en_US |
dc.date.accessioned | 2023-03-10T10:16:11Z | - |
dc.date.available | 2023-03-10T10:16:11Z | - |
dc.date.issued | 2022 | en_US |
dc.identifier.issn | 2076-393X | en_US |
dc.identifier.uri | http://hdl.handle.net/10553/121019 | - |
dc.description.abstract | The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development. | en_US |
dc.language | eng | en_US |
dc.relation.ispartof | Vaccines | en_US |
dc.source | Vaccines [ISSN 2076-393X], v.10 (7), 1105 | en_US |
dc.subject | 310905 Microbiología | en_US |
dc.subject.other | Eulipotyphla | en_US |
dc.subject.other | Insectivores | en_US |
dc.subject.other | Mammals | en_US |
dc.subject.other | Innate immunity | en_US |
dc.subject.other | Antimicrobial peptide | en_US |
dc.subject.other | Talpidae | en_US |
dc.title | Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis | en_US |
dc.type | info:eu-repo/semantics/article | en_US |
dc.type | Article | en_US |
dc.identifier.doi | 10.3390/vaccines10071105 | en_US |
dc.identifier.scopus | 2-s2.0-85137299451 | - |
dc.identifier.isi | WOS:000833692800001 | - |
dc.contributor.orcid | #NODATA# | - |
dc.contributor.orcid | 0000-0001-8413-8426 | - |
dc.contributor.orcid | 0000-0002-6012-8255 | - |
dc.contributor.orcid | 0000-0001-7195-7211 | - |
dc.contributor.orcid | #NODATA# | - |
dc.contributor.orcid | 0000-0002-0184-2037 | - |
dc.contributor.orcid | 0000-0003-4663-5565 | - |
dc.identifier.issue | 7 | - |
dc.relation.volume | 10 | en_US |
dc.investigacion | Ciencias de la Salud | en_US |
dc.type2 | Artículo | en_US |
dc.utils.revision | Sí | en_US |
dc.date.coverdate | Julio 2022 | en_US |
dc.identifier.ulpgc | No | en_US |
dc.contributor.buulpgc | BU-VET | en_US |
dc.description.sjr | 1,655 | |
dc.description.jcr | 7,8 | |
dc.description.sjrq | Q1 | |
dc.description.jcrq | Q1 | |
dc.description.scie | SCIE | |
dc.description.miaricds | 10,4 | |
item.fulltext | Con texto completo | - |
item.grantfulltext | open | - |
crisitem.author.dept | GIR IUSA-ONEHEALTH 4. Producción y Biotecnología Animal | - |
crisitem.author.dept | IU de Sanidad Animal y Seguridad Alimentaria | - |
crisitem.author.dept | Departamento de Patología Animal, Producción Animal, Bromatología y Tecnología de Los Alimentos | - |
crisitem.author.orcid | 0000-0002-0184-2037 | - |
crisitem.author.parentorg | IU de Sanidad Animal y Seguridad Alimentaria | - |
crisitem.author.fullName | Morales De La Nuez, Antonio José | - |
Colección: | Artículos |
Los elementos en ULPGC accedaCRIS están protegidos por derechos de autor con todos los derechos reservados, a menos que se indique lo contrario.