Please use this identifier to cite or link to this item:
https://accedacris.ulpgc.es/jspui/handle/10553/149556
| Title: | Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis | Authors: | Otazo-Pérez, Andrea Asensio-Calavia, Patricia González-Acosta, Sergio Baca-González, Victoria López, Manuel R. Morales De La Nuez, Antonio José Pérez de la Lastra, José Manuel |
UNESCO Clasification: | 310903 Inmunología | Keywords: | Eulipotyphla Insectivores Mammals: innate immunity Antimicrobial peptide Talpidae |
Issue Date: | 2022 | Journal: | Vaccines | Abstract: | The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development. | URI: | https://accedacris.ulpgc.es/jspui/handle/10553/149556 | ISSN: | 2076-393X | DOI: | 10.3390/vaccines10071105 | Source: | Vaccines [ISSN 2076-393X], v. 10 (7), (Julio 2022) |
| Appears in Collections: | Artículos |
Items in accedaCRIS are protected by copyright, with all rights reserved, unless otherwise indicated.