Identificador persistente para citar o vincular este elemento: https://accedacris.ulpgc.es/handle/10553/121019
Título: Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis
Autores/as: Otazo-Perez, Andrea
Asensio-Calavia, Patricia
Gonzalez-Acosta, Sergio
Baca-Gonzalez, Victoria
López, Manuel R.
Morales De La Nuez, Antonio José 
Pérez de la Lastra, José Manuel
Clasificación UNESCO: 310905 Microbiología
Palabras clave: Eulipotyphla
Insectivores
Mammals
Innate immunity
Antimicrobial peptide, et al.
Fecha de publicación: 2022
Publicación seriada: Vaccines 
Resumen: The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development.
URI: https://accedacris.ulpgc.es/handle/10553/121019
ISSN: 2076-393X
DOI: 10.3390/vaccines10071105
Fuente: Vaccines [ISSN 2076-393X], v.10 (7), 1105
Colección:Artículos
Adobe PDF (7,89 MB)
Vista completa

Google ScholarTM

Verifica

Altmetric


Comparte



Exporta metadatos



Los elementos en ULPGC accedaCRIS están protegidos por derechos de autor con todos los derechos reservados, a menos que se indique lo contrario.